Mouse Pde5a protein

Produktübersicht

• Artikelname: Mouse Pde5a protein
• Artikelnummer: BYT-ORB605031
• Hersteller Artikelnummer: orb605031
• Alternativnummer: BYT-ORB605031-20,BYT-ORB605031-100,BYT-ORB605031-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)

Produktbeschreibung

This Mouse Pde5a protein spans the amino acid sequence from region 154-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 26.1 kDa
• UniProt: Q8CG03
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Partial

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.