Animal RPS13 protein

Produktübersicht

• Artikelname: Animal RPS13 protein
• Artikelnummer: BYT-ORB605041
• Hersteller Artikelnummer: orb605041
• Alternativnummer: BYT-ORB605041-20,BYT-ORB605041-100,BYT-ORB605041-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: RPS13, 40S ribosomal protein S13

Produktbeschreibung

This Animal RPS13 protein spans the amino acid sequence from region 2-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 23.9 kDa
• UniProt: Q8I7D6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.