Mouse Pla2g15 protein

Artikelnummer: BYT-ORB605063
Artikelname: Mouse Pla2g15 protein
Artikelnummer: BYT-ORB605063
Hersteller Artikelnummer: orb605063
Alternativnummer: BYT-ORB605063-20,BYT-ORB605063-100,BYT-ORB605063-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 1-O-acylceramide synthase1 Short name, ACS LCAT-like lysophospholipase Short name, LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name, LPLA2
This Mouse Pla2g15 protein spans the amino acid sequence from region 34-412aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 50.5 kDa
UniProt: Q8VEB4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTT
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pla2g15.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pla2g15.