Human MYD88 protein

Produktübersicht

• Artikelname: Human MYD88 protein
• Artikelnummer: BYT-ORB605094
• Hersteller Artikelnummer: orb605094
• Alternativnummer: BYT-ORB605094-20,BYT-ORB605094-100,BYT-ORB605094-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Mutant myeloid differentiation primary response 88, MYD 88, Myd88, MYD88_HUMAN, MYD88D, Myeloid differentiation marker 88, Myeloid differentiation primary response 88, Myeloid differentiation primary response gene (88), Myeloid differentiation primary response gene 88, Myeloid differentiation primary response gene, Myeloid differentiation primary response protein MyD88, OTTHUMP00000161718, OTTHUMP00000208595, OTTHUMP00000209058, OTTHUMP00000209059, OTTHUMP00000209060

Produktbeschreibung

This Human MYD88 protein spans the amino acid sequence from region 1-296aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 37.2 kDa
• UniProt: Q99836
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MYD88.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MYD88.