Mouse Upk3a protein

Artikelnummer: BYT-ORB605106
Artikelname: Mouse Upk3a protein
Artikelnummer: BYT-ORB605106
Hersteller Artikelnummer: orb605106
Alternativnummer: BYT-ORB605106-20,BYT-ORB605106-100,BYT-ORB605106-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uroplakin III Short name, UPIII Upk3
This Mouse Upk3a protein spans the amino acid sequence from region 19-207aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 25.5 kDa
UniProt: Q9JKX8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.