Mouse Htra1 protein

Produktübersicht

• Artikelname: Mouse Htra1 protein
• Artikelnummer: BYT-ORB605142
• Hersteller Artikelnummer: orb605142
• Alternativnummer: BYT-ORB605142-20,BYT-ORB605142-100,BYT-ORB605142-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: High-temperature requirement A serine peptidase 1 (Serine protease 11) (Htra) (Prss11)

Produktbeschreibung

This Mouse Htra1 protein spans the amino acid sequence from region 141-480aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 39.0 kDa
• UniProt: Q9R118
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KLRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAVTKKKYIGIRMMSLTSSKA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Htra1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Htra1.