Human AK3 protein

Artikelnummer: BYT-ORB605151
Artikelname: Human AK3 protein
Artikelnummer: BYT-ORB605151
Hersteller Artikelnummer: orb605151
Alternativnummer: BYT-ORB605151-20,BYT-ORB605151-100,BYT-ORB605151-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Adenylate kinase 3 (AK 3) (Adenylate kinase 3 alpha-like 1) (AK3L1) (AK6) (AKL3L)
This Human AK3 protein spans the amino acid sequence from region 1-227aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.6 kDa
UniProt: Q9UIJ7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.