Human HAPLN1 protein

Artikelnummer: BYT-ORB605225
Artikelname: Human HAPLN1 protein
Artikelnummer: BYT-ORB605225
Hersteller Artikelnummer: orb605225
Alternativnummer: BYT-ORB605225-20,BYT-ORB605225-100,BYT-ORB605225-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cartilage-linking protein 1 Short name, Cartilage-link protein Proteoglycan link protein CRTL1
This Human HAPLN1 protein spans the amino acid sequence from region 16-354aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 41 kDa
UniProt: P10915
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) HAPLN1.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) HAPLN1.