Human KLRK1 protein

Produktübersicht

• Artikelname: Human KLRK1 protein
• Artikelnummer: BYT-ORB605229
• Hersteller Artikelnummer: orb605229
• Alternativnummer: BYT-ORB605229-20,BYT-ORB605229-100,BYT-ORB605229-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)

Produktbeschreibung

This Human KLRK1 protein spans the amino acid sequence from region 78-216aa. Purity: Greater than 93% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 43.6 kDa
• UniProt: P26718
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 93% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human ULBP1, the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml. Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human ULBP1, the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.

Human KLRK1 protein Fc tag captured on COOH chip can bind Human ULBP1 protein Fc/myc tag with an affinity constant of 2.27 nM as detected by LSPR Assay.

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.

The purity of KLRK1 was greater than 90% as determined by SEC-HPLC.