Human NPHS1 protein
Artikelnummer:
BYT-ORB605238
- Bilder (3)
| Artikelname: | Human NPHS1 protein |
| Artikelnummer: | BYT-ORB605238 |
| Hersteller Artikelnummer: | orb605238 |
| Alternativnummer: | BYT-ORB605238-20,BYT-ORB605238-100,BYT-ORB605238-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Renal glomerulus-specific cell adhesion receptor |
| This Human NPHS1 protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 28.7 kDa |
| UniProt: | O60500 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: Partial |



