Human MADCAM1 protein

Produktübersicht

• Artikelname: Human MADCAM1 protein
• Artikelnummer: BYT-ORB605268
• Hersteller Artikelnummer: orb605268
• Alternativnummer: BYT-ORB605268-20,BYT-ORB605268-100,BYT-ORB605268-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Short name, MAdCAM-1 Short name, hMAdCAM-1

Produktbeschreibung

Recombinant Human Mucosal addressin cell adhesion molecule 1(MADCAM1),partial

Produkteigenschaften

• Molekulargewicht: 34.9 kDa
• UniProt: Q13477
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Extracellular Domain

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) MADCAM1.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) MADCAM1.