Human BMP3 protein

Artikelnummer: BYT-ORB605297
Artikelname: Human BMP3 protein
Artikelnummer: BYT-ORB605297
Hersteller Artikelnummer: orb605297
Alternativnummer: BYT-ORB605297-20,BYT-ORB605297-100,BYT-ORB605297-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Bone morphogenetic protein 3A , BMP-3AOsteogenin
This Human BMP3 protein spans the amino acid sequence from region 363-472aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 16.4 kDa
UniProt: P12645
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) BMP3.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) BMP3.