Human CSF1 protein

Produktübersicht

• Artikelname: Human CSF1 protein
• Artikelnummer: BYT-ORB605310
• Hersteller Artikelnummer: orb605310
• Alternativnummer: BYT-ORB605310-20,BYT-ORB605310-100,BYT-ORB605310-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Macrophage colony-stimulating factor 1, CSF-1, M-CSF, MCSF, Lanimostim, Proteoglycan macrophage colony-stimulating factor, Processed macrophage colony-stimulating factor 1, Macrophage colony-stimulating factor 1 43 kDa subunit, CSF1

Produktbeschreibung

This Human CSF1 protein spans the amino acid sequence from region 33-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 19.9 kDa
• UniProt: P09603
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL. Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of CSF1 was greater than 90% as determined by SEC-HPLC