Plant Viscum album Beta-galactoside-specific lectin 1 protein

Produktübersicht

• Artikelname: Plant Viscum album Beta-galactoside-specific lectin 1 protein
• Artikelnummer: BYT-ORB605408
• Hersteller Artikelnummer: orb605408
• Alternativnummer: BYT-ORB605408-20,BYT-ORB605408-100,BYT-ORB605408-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Beta-galactoside-specific lectin I Viscumin

Produktbeschreibung

This Plant Viscum album Beta-galactoside-specific lectin 1 protein spans the amino acid sequence from region 34-287aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 30.4 kDa
• UniProt: P81446
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Viscum album (European mistletoe)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Viscum album (European mistletoe). Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Viscum album (European mistletoe).

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Viscum album (European mistletoe).