Fungi PRA1 protein

Produktübersicht

• Artikelname: Fungi PRA1 protein
• Artikelnummer: BYT-ORB605410
• Hersteller Artikelnummer: orb605410
• Alternativnummer: BYT-ORB605410-20,BYT-ORB605410-100,BYT-ORB605410-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 58 kDa fibrinogen-binding mannoprotein FBP1

Produktbeschreibung

This Fungi PRA1 protein spans the amino acid sequence from region 16-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 33.4 kDa
• UniProt: P87020
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.