Bacteria Moraxella bovis Fimbrial protein 1 protein

Produktübersicht

• Artikelname: Bacteria Moraxella bovis Fimbrial protein 1 protein
• Artikelnummer: BYT-ORB605423
• Hersteller Artikelnummer: orb605423
• Alternativnummer: BYT-ORB605423-20,BYT-ORB605423-100,BYT-ORB605423-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Alpha-pilin (Fimbrial protein I) (I pilin)

Produktbeschreibung

This Bacteria Moraxella bovis Fimbrial protein 1 protein spans the amino acid sequence from region 7-159aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 29.2 kDa
• UniProt: P20657
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Moraxella bovis
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVSGELAAGKTAVDAALFEGKTPVLSEESSTSKENIGLTSSETSTKPRSNLMASVELTGFADNGAGTISATLGNKANKDIAKTVITQERTTDGVWTCKIDGSQAAKYKEKFNPTGCVKK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Moraxella bovis. Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Moraxella bovis.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Moraxella bovis.