Virus ECM31 protein

Produktübersicht

• Artikelname: Virus ECM31 protein
• Artikelnummer: BYT-ORB605434
• Hersteller Artikelnummer: orb605434
• Alternativnummer: BYT-ORB605434-20,BYT-ORB605434-100,BYT-ORB605434-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Extracellular matrix protein 31 (Ketopantoate hydroxymethyltransferase)

Produktbeschreibung

This Virus ECM31 protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 38.3 kDa
• UniProt: P38122
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNIMKRQLCTSSKRFFSTAKNVVKYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) ECM31.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) ECM31.