Plant XERO1 protein

Produktübersicht

• Artikelname: Plant XERO1 protein
• Artikelnummer: BYT-ORB605442
• Hersteller Artikelnummer: orb605442
• Alternativnummer: BYT-ORB605442-20,BYT-ORB605442-100,BYT-ORB605442-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: DHNX

Produktbeschreibung

This Plant XERO1 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 15.5 kDa
• UniProt: P25863
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Arabidopsis thaliana (Mouse-ear cress)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) XERO1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) XERO1.