Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein

Artikelnummer: BYT-ORB605490
Artikelname: Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein
Artikelnummer: BYT-ORB605490
Hersteller Artikelnummer: orb605490
Alternativnummer: BYT-ORB605490-20,BYT-ORB605490-100,BYT-ORB605490-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Limulus clotting factor C, FC, EC 3.4.21.84) [Cleaved into, Limulus clotting factor C heavy chain, Limulus clotting factor C light chain, Limulus clotting factor C chain A, Limulus clotting factor C chain B]
This Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein spans the amino acid sequence from region 691-1019aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 39.2 kDa
UniProt: Q26422
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYYELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRSPFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEGYKEADLPLTV
Anwendungsbeschreibung: Biological Origin: Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda).
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda).