Plant UGT89C1 protein

Produktübersicht

• Artikelname: Plant UGT89C1 protein
• Artikelnummer: BYT-ORB605533
• Hersteller Artikelnummer: orb605533
• Alternativnummer: BYT-ORB605533-20,BYT-ORB605533-100,BYT-ORB605533-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Flavonol 7-O-rhamnosyltransferase UDP-rhamnose, flavonol 7-O-rhamnosyltransferase

Produktbeschreibung

This Plant UGT89C1 protein spans the amino acid sequence from region 1-435aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 50.6 kDa
• UniProt: Q9LNE6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Arabidopsis thaliana (Mouse-ear cress)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTTTTTKKPHVLVIPFPQSGHMVPHLDLTHQILLRGATVTVLVTPKNSSYLDALRSLHSPEHFKTLILPFPSHPCIPSGVESLQQLPLEAIVHMFDALSRLHDPLVDFLSRQPPSDLPDAILGSSFLSPWINKVADAFSIKSISFLPINAHSISVMWAQEDRSFFNDLETATTESYGLVINSFYDLEPEFVETVKTRFLNHHRIWTVGPLLPFKAGVDRGGQSSIPPAKVSAWLDSCPEDNSVVYVGFGSQIRLT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Full length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) UGT89C1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) UGT89C1.