Human EFNA5 protein
Artikelnummer:
BYT-ORB624106
- Bilder (3)
| Artikelname: | Human EFNA5 protein |
| Artikelnummer: | BYT-ORB624106 |
| Hersteller Artikelnummer: | orb624106 |
| Alternativnummer: | BYT-ORB624106-1,BYT-ORB624106-100,BYT-ORB624106-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | AL-1 (EPH-related receptor tyrosine kinase ligand 7) (LERK-7) |
| This Human EFNA5 protein spans the amino acid sequence from region 21-203aa. Purity: Greater than 93% as determined by SDS-PAGE. |
| Molekulargewicht: | 50.1 kDa |
| UniProt: | P52803 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 93% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 µg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 µg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. |
|
|
Human EPHA3 protein his tag captured on COOH chip can bind Human EFNA5 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay. |
Produktgarantie und fachkundiger Support
