Human TACSTD2 protein

Produktübersicht

• Artikelname: Human TACSTD2 protein
• Artikelnummer: BYT-ORB624117
• Hersteller Artikelnummer: orb624117
• Alternativnummer: BYT-ORB624117-1,BYT-ORB624117-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

Produktbeschreibung

This Human TACSTD2 protein spans the amino acid sequence from region 27-274aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 56.8 kDa
• UniProt: P09758
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured in cell activity assay using U937 cells, the EC50 for this effect is 190.2-298.6 ng/ml.

The purity of TACSTD2 was greater than 95% as determined by SEC-HPLC