Human TACSTD2 protein
Artikelnummer:
BYT-ORB624117
- Bilder (3)
| Artikelname: | Human TACSTD2 protein |
| Artikelnummer: | BYT-ORB624117 |
| Hersteller Artikelnummer: | orb624117 |
| Alternativnummer: | BYT-ORB624117-1,BYT-ORB624117-100 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2) |
| This Human TACSTD2 protein spans the amino acid sequence from region 27-274aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 56.8 kDa |
| UniProt: | P09758 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



