Human Tnfrsf17 protein

Produktübersicht

• Artikelname: Human Tnfrsf17 protein
• Artikelnummer: BYT-ORB624119
• Hersteller Artikelnummer: orb624119
• Alternativnummer: BYT-ORB624119-1,BYT-ORB624119-100,BYT-ORB624119-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: B-cell maturation protein (CD_antigen: CD269)

Produktbeschreibung

This Human Tnfrsf17 protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 34.8 kDa
• UniProt: Q02223
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 µg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 µg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 10 µg/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml.

Human TNFSF13B protein Fc tag captured on COOH chip can bind Human BCMA protein Fc tag with an affinity constant of 39 nM as detected by LSPR Assay.

Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 µg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.1752-0.3657 ng/ml.