Human CD276 protein

Produktübersicht

• Artikelname: Human CD276 protein
• Artikelnummer: BYT-ORB624121
• Hersteller Artikelnummer: orb624121
• Alternativnummer: BYT-ORB624121-1,BYT-ORB624121-100,BYT-ORB624121-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 4Ig-B7-H3 (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD276)

Produktbeschreibung

This Human CD276 protein spans the amino acid sequence from region 29-245aa. Purity: Greater than 93% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 53.4 kDa
• UniProt: Q5ZPR3
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 93% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 µg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 µg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.