Human BTLA protein

Produktübersicht

• Artikelname: Human BTLA protein
• Artikelnummer: BYT-ORB624122
• Hersteller Artikelnummer: orb624122
• Alternativnummer: BYT-ORB624122-1,BYT-ORB624122-100,BYT-ORB624122-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (B- and T-lymphocyte-associated protein)(CD272)

Produktbeschreibung

This Human BTLA protein spans the amino acid sequence from region 31-150aa. Purity: Greater than 94% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 43.9 kDa
• UniProt: Q7Z6A9
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 94% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 µg/ml can bind biotinylated human TNFRSF14, the EC50 is 137.8-233.4 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 µg/ml can bind biotinylated human TNFRSF14, the EC50 is 137.8-233.4 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2µg/ml can bind Anti-BTLA recombinant antibody, the EC50 is 1.763-3.542 ng/mL.