Human Novel Coronavirus Spike glycoprotein(S) protein

Artikelnummer: BYT-ORB668861
Artikelname: Human Novel Coronavirus Spike glycoprotein(S) protein
Artikelnummer: BYT-ORB668861
Hersteller Artikelnummer: orb668861
Alternativnummer: BYT-ORB668861-20,BYT-ORB668861-100,BYT-ORB668861-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Human Novel Coronavirus Spike glycoprotein(S) protein spans the amino acid sequence from region 319-541aa (V367F). Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27.9 kDa
UniProt: P0DTC2
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V367F) at 5 µg/ml can bind human ACE2, the EC50 is 65.58-90.16 ng/ml. Application Notes: SARS-CoV-2 Related Proteins
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V367F) at 5 µg/ml can bind human ACE2, the EC50 is 65.58-90.16 ng/ml.