Human CCR8 protein

Artikelnummer: BYT-ORB705034
Artikelname: Human CCR8 protein
Artikelnummer: BYT-ORB705034
Hersteller Artikelnummer: orb705034
Alternativnummer: BYT-ORB705034-100,BYT-ORB705034-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CC chemokine receptor CHEMR1 CMKBRL2 Chemokine receptor-like 1 Short name: CKR-L1 GPR-CY6 Short name: GPRCY6 TER1 CD_antigen: CDw198
This Human CCR8 protein spans the amino acid sequence from region 1-355aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 41.7 kDa
UniProt: P51685
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-PAGE analysis of Human CCR8 protein.