Human TNFRSF18 protein

Produktübersicht

• Artikelname: Human TNFRSF18 protein
• Artikelnummer: BYT-ORB705128
• Hersteller Artikelnummer: orb705128
• Alternativnummer: BYT-ORB705128-1,BYT-ORB705128-100,BYT-ORB705128-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

This Human TNFRSF18 protein spans the amino acid sequence from region 26-161aa. Purity: Greater than 92% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 40.8 kDa
• UniProt: Q9Y5U5
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 92% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 µg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml.

Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.