Human GDF7 protein

Artikelnummer: BYT-ORB705305
Artikelname: Human GDF7 protein
Artikelnummer: BYT-ORB705305
Hersteller Artikelnummer: orb705305
Alternativnummer: BYT-ORB705305-10,BYT-ORB705305-100,BYT-ORB705305-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GDF-7, BMP12
This Human GDF7 protein spans the amino acid sequence from region 322-450aa. Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.
Molekulargewicht: 14.0 kDa
UniProt: Q7Z4P5
Puffer: Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Quelle: Homo sapiens (Human)
Reinheit: > 95 % as determined by SDS-PAGE and HPLC analyses.
Formulierung: Lyophilized powder
Sequenz: TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 µg/ml, corresponding to a specific activity of > 1000 IU/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.