Human GDF6 protein

Produktübersicht

• Artikelname: Human GDF6 protein
• Artikelnummer: BYT-ORB705306
• Hersteller Artikelnummer: orb705306
• Alternativnummer: BYT-ORB705306-10,BYT-ORB705306-100,BYT-ORB705306-500
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: BMP13, GDF16, GDF-6, BMP-13

Produktbeschreibung

This Human GDF6 protein spans the amino acid sequence from region 336-455aa. Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.

Produkteigenschaften

• Molekulargewicht: 13.6 kDa
• UniProt: Q6KF10
• Puffer: Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Quelle: Homo sapiens (Human)
• Reinheit: > 95 % as determined by SDS-PAGE and HPLC analyses.
• Formulierung: Lyophilized powder
• Sequenz: TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 µg/ml, corresponding to a specific activity of > 500 IU/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.