E. coli YTFE protein

Artikelnummer: BYT-ORB705317
Artikelname: E. coli YTFE protein
Artikelnummer: BYT-ORB705317
Hersteller Artikelnummer: orb705317
Alternativnummer: BYT-ORB705317-1,BYT-ORB705317-100,BYT-ORB705317-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Regulator of cell morphogenesis and NO signaling
This E. coli YTFE protein spans the amino acid sequence from region 1-220aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 51.9 kDa
UniProt: P69506
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 µg/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 µg/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 µg/ml.