E. coli ycbX protein

Artikelnummer: BYT-ORB705319
Artikelname: E. coli ycbX protein
Artikelnummer: BYT-ORB705319
Hersteller Artikelnummer: orb705319
Alternativnummer: BYT-ORB705319-1,BYT-ORB705319-100,BYT-ORB705319-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This E. coli ycbX protein spans the amino acid sequence from region 1-369aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 67.6 kDa
UniProt: P75863
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MATLIRLFIHPVKSMRGIGLTHALADVSGLAFDRIFMITEPDGTFITARQFPQMVRFTPSPVHDGLHLTAPDGSSAYVRFADFATQDAPTEVWGTHFTARIAPDAINKWLSGFFSREVQLRWVGPQMTRRVKRHNTVPLSFADGYPYLLANEASLRDLQQRCPASVKMEQFRPNLVVSGASAWEEDRWKVIRIGDVVFDVVKPCSRCIFTTVSPEKGQKHPAGEPLKTLQSFRTAQDNGDVDFGQNLIARNSGVI
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ldcC at 2 µg/ml can bind human ycbX, the EC50 of human ycbX protein is 40.54-47.97 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb705319
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.