Human GHR protein

Artikelnummer: BYT-ORB705333
Artikelname: Human GHR protein
Artikelnummer: BYT-ORB705333
Hersteller Artikelnummer: orb705333
Alternativnummer: BYT-ORB705333-1,BYT-ORB705333-100,BYT-ORB705333-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Somatotropin receptor (Serum-binding protein)
This Human GHR protein spans the amino acid sequence from region 27-264aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.8 kDa
UniProt: P10912
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 µg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml.
Human GH1 protein his/myc tag captured on COOH chip can bind Human GHR protein Fc tag with an affinity constant of 6.1 nM as detected by LSPR Assay.
The purity of GHR was greater than 95% as determined by SEC-HPLC