Monkey ACE2 protein

Produktübersicht

• Artikelname: Monkey ACE2 protein
• Artikelnummer: BYT-ORB705341
• Hersteller Artikelnummer: orb705341
• Alternativnummer: BYT-ORB705341-20,BYT-ORB705341-100,BYT-ORB705341-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

Recombinant Macaca fascicularis Angiotensin-converting enzyme(ACE2),partial

Produkteigenschaften

• Molekulargewicht: 112.7 kDa
• UniProt: A0A2K5X283
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Reinheit: Greater than 93% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGEKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKDYGDYWRGNYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPAHLLGDMWG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 5 µg/ml can bind Cynomolgus-ACE2, the EC50 is 5.638-9.496 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference