Human RBP4 protein

Produktübersicht

• Artikelname: Human RBP4 protein
• Artikelnummer: BYT-ORB705342
• Hersteller Artikelnummer: orb705342
• Alternativnummer: BYT-ORB705342-1,BYT-ORB705342-100,BYT-ORB705342-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Plasma retinol-binding protein)(PRBP)(RBP)

Produktbeschreibung

This Human RBP4 protein spans the amino acid sequence from region 19-201aa. Purity: Greater than 94% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 50 kDa
• UniProt: P02753
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 94% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 µg/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 µg/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.

The purity of RBP4 was greater than 90% as determined by SEC-HPLC.