Human SECTM1 protein

Artikelnummer: BYT-ORB705343
Artikelname: Human SECTM1 protein
Artikelnummer: BYT-ORB705343
Hersteller Artikelnummer: orb705343
Alternativnummer: BYT-ORB705343-1,BYT-ORB705343-100,BYT-ORB705343-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Protein K-12)(K12)
This Human SECTM1 protein spans the amino acid sequence from region 29-145aa. Purity: Greater than 92% as determined by SDS-PAGE.
Molekulargewicht: 41.6 kDa
UniProt: Q8WVN6
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 92% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 µg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 µg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.
Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.