Bacterial pbpD protein

Produktübersicht

• Artikelname: Bacterial pbpD protein
• Artikelnummer: BYT-ORB8168
• Hersteller Artikelnummer: orb8168
• Alternativnummer: BYT-ORB8168-1,BYT-ORB8168-100,BYT-ORB8168-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: pbpD, BSU31490, Penicillin-binding protein 4, PBP 4) [Includes, Penicillin-insensitive transglycosylase, EC 2.4.1.129, Peptidoglycan TGase), Penicillin-sensitive transpeptidase, EC 3.4.16.4, DD-transpeptidase)]

Produktbeschreibung

This Bacterial pbpD protein spans the amino acid sequence from region 213-450aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 43 kDa
• UniProt: P40750
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bacillus subtilis (strain 168)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Bacillus subtilis (strain 168). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 213-450aaSequence Info: PartialGlycerol content: 0.5

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) pbpD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) pbpD.