Mouse Jag1 protein

Artikelnummer: BYT-ORB8202
Artikelname: Mouse Jag1 protein
Artikelnummer: BYT-ORB8202
Hersteller Artikelnummer: orb8202
Alternativnummer: BYT-ORB8202-1,BYT-ORB8202-100,BYT-ORB8202-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CD_antigen, CD339
This Mouse Jag1 protein spans the amino acid sequence from region 33-334aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 53.6 kDa
UniProt: Q9QXX0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETN
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 33-334aaSequence Info: PartialGlycerol content: 0.1
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.