Bacterial amiB2 protein

Produktübersicht

• Artikelname: Bacterial amiB2 protein
• Artikelnummer: BYT-ORB8243
• Hersteller Artikelnummer: orb8243
• Alternativnummer: BYT-ORB8243-1,BYT-ORB8243-100,BYT-ORB8243-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: amiB2, Rv1263, MTCY50.19cPutative amidase AmiB2, EC 3.5.1.4

Produktbeschreibung

This Bacterial amiB2 protein spans the amino acid sequence from region 1-462aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 69.1 kDa
• UniProt: P9WQ97
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERLPLLGVPIAIKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGSAAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATTTVPGPEGEFVAAAARQPGRLRIA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-462aaSequence Info: Full LengthGlycerol content: 0.5Relevance: A monocarboxylic acid amide + H2O = a monocarboxylate + NH3.Protein Description: Full Length

Bilder

Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.