Drosophila lush protein

Produktübersicht

• Artikelname: Drosophila lush protein
• Artikelnummer: BYT-ORB8250
• Hersteller Artikelnummer: orb8250
• Alternativnummer: BYT-ORB8250-1,BYT-ORB8250-100,BYT-ORB8250-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: lush, Obp76a, Obp76c, CG8807, General odorant-binding protein lush

Produktbeschreibung

This Drosophila lush protein spans the amino acid sequence from region 30-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 19.2 kDa
• UniProt: O02372
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Drosophila melanogaster (Fruit fly)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 30-153aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) lush.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) lush.