Recombinant Human Hyaluronan and proteoglycan link protein 3 (HAPLN3)

Produktübersicht

• Artikelname: Recombinant Human Hyaluronan and proteoglycan link protein 3 (HAPLN3)
• Artikelnummer: CSB-BP010132HU
• Hersteller Artikelnummer: CSB-BP010132HU
• Alternativnummer: CSB-BP010132HU-1, CSB-BP010132HU-100, CSB-BP010132HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: EXLD1

Produkteigenschaften

• Molekulargewicht: 41.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q96S86
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 18-360aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQDKEHDVSLEIQDLRLEDYGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQFNFHEGQQVCAEQAAVVASFEQLFRAWEEGLDWCNAGWLQDATVQYPIMLPRQPCGGPGLAPGVRSYGPRHRRLHRYDVFCFATALKGRVYYLE