Recombinant Human Nuclear factor NF-kappa-B p100 subunit (NFKB2), partial Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Human Nuclear factor NF-kappa-B p100 subunit (NFKB2), partial Preis auf Anfrage
• Artikelnummer: CSB-BP1044HU
• Hersteller Artikelnummer: CSB-BP1044HU
• Alternativnummer: CSB-BP1044HU-20, CSB-BP1044HU-100, CSB-BP1044HU-1
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: Nuclear factor NF-kappa-B p100 subunit, DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, Oncogene Lyt-10, Lyt10, [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] NFKB2 LYT10

Produkteigenschaften

• Molekulargewicht: /
• Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
• UniProt: Q00653
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: Partial
• Target-Kategorie: PYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTP

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.