Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial

Artikelnummer: CSB-BP4885MRG
Artikelname: Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial
Artikelnummer: CSB-BP4885MRG
Hersteller Artikelnummer: CSB-BP4885MRG
Alternativnummer: CSB-BP4885MRG-1, CSB-BP4885MRG-100, CSB-BP4885MRG-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 70.3 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Strep II-tagged
UniProt: A0A1U7QTA1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Baculovirus
Expression System: 20-604aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKLAKNYSLQEVQNLTIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMNTYPSYISPTGCLPAHLLGDMWGRF
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.