Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

Artikelnummer: CSB-CF023924HU
Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial
Artikelnummer: CSB-CF023924HU
Hersteller Artikelnummer: CSB-CF023924HU
Alternativnummer: CSB-CF023924HU-100, CSB-CF023924HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Serine protease 10
Molekulargewicht: 46.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O15393
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 106-492aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.