Recombinant Bovine Muellerian-inhibiting factor (AMH), partial
Artikelnummer:
CSB-EP001666BO1B1
- Bilder (0)
| Artikelname: | Recombinant Bovine Muellerian-inhibiting factor (AMH), partial |
| Artikelnummer: | CSB-EP001666BO1B1 |
| Hersteller Artikelnummer: | CSB-EP001666BO1b1 |
| Alternativnummer: | CSB-EP001666BO1B1-1,CSB-EP001666BO1B1-100,CSB-EP001666BO1B1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Anti-Muellerian hormone,AMH,Muellerian-inhibiting substance,MIS |
| Molekulargewicht: | 18.5 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P03972 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 475-575aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GPCALRELSVDLRAERSVLIPETYQANNCQGACGWPQSDRNPRYGNHVVLLLKMQARGATLARPPCCVPTAYTGKLLISLSEERISAHHVPNMVATECGCR |
Produktgarantie und fachkundiger Support
