Recombinant Mouse Glycoprotein hormones alpha chain (Cga)

Artikelnummer: CSB-EP005293MO
Artikelname: Recombinant Mouse Glycoprotein hormones alpha chain (Cga)
Artikelnummer: CSB-EP005293MO
Hersteller Artikelnummer: CSB-EP005293MO
Alternativnummer: CSB-EP005293MO-1, CSB-EP005293MO-100, CSB-EP005293MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Anterior pituitary glycoprotein hormones common subunit alpha,Follicle-stimulating hormone alpha chain,Follitropin alpha chain,Luteinizing hormone alpha chain,Lutropin alpha chain,Thyroid-stimulating hormone alpha chain,Thyrotropin alpha chain
Molekulargewicht: 17.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P01216
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.242.
Quelle: E.coli
Expression System: 25-120aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
Anwendungsbeschreibung: Research Areas: Signal Transduction