Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B)

Produktübersicht

• Artikelname: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B)
• Artikelnummer: CSB-EP008544HU
• Hersteller Artikelnummer: CSB-EP008544HU
• Alternativnummer: CSB-EP008544HU-1,CSB-EP008544HU-100,CSB-EP008544HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: Fc-gamma RIII-beta,CD16-I,Fc-gamma RIII,Fc-gamma RIIIb,FcRIII,FcRIIIb,FcR-10,IgG Fc receptor III-1,CD antigen CD16b

Produkteigenschaften

• Molekulargewicht: 24.9 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: O75015
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 17-200aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.