Recombinant Human Gamma-glutamyl hydrolase (GGH), partial

Artikelnummer: CSB-EP009389HU1
Artikelname: Recombinant Human Gamma-glutamyl hydrolase (GGH), partial
Artikelnummer: CSB-EP009389HU1
Hersteller Artikelnummer: CSB-EP009389HU1
Alternativnummer: CSB-EP009389HU1-1, CSB-EP009389HU1-100, CSB-EP009389HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Conjugase)(GH)(Gamma-Glu-X carboxypeptidase)
Molekulargewicht: 43.9 kDa
Tag: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
UniProt: Q92820
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 219-293aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.