Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial

Artikelnummer: CSB-EP009514RA1
Artikelname: Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial
Artikelnummer: CSB-EP009514RA1
Hersteller Artikelnummer: CSB-EP009514RA1
Alternativnummer: CSB-EP009514RA1-1, CSB-EP009514RA1-100, CSB-EP009514RA1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Molekulargewicht: 17.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P32301
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 22-135aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.