Recombinant Cricetulus griseus Glutamine synthetase (GLUL)

Artikelnummer: CSB-EP009553DXU
Artikelname: Recombinant Cricetulus griseus Glutamine synthetase (GLUL)
Artikelnummer: CSB-EP009553DXU
Hersteller Artikelnummer: CSB-EP009553DXU
Alternativnummer: CSB-EP009553DXU-1, CSB-EP009553DXU-100, CSB-EP009553DXU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: GS Glutamate decarboxylase Glutamate--ammonia ligase
Molekulargewicht: 58.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P04773
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-373aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNF
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.